Rajapur Road railway station

»
»
»
Rajapur Road railway station

all trains stopping at this railway station

50
5.0
Overall rating: /5.0 - from total - see latest 10 reviews
Cleanliness: /5.0
Food: /5.0
Safety: /5.0
list of trains
train no. train name from to
00128 Running Status Madgaon - CSMT Kolhapur One Way Special Fare Special Madgaon C Shahumharaj T
01415 Running Status Swv Pnvl Spl Sawantwadi Road Panvel
01194 Running Status Krmi Ltt Spl Thivim C Shivaji Mah T
01047 Running Status Pnvl Swv Spl Panvel Sawantwadi Road
00116 Running Status Mao Bikaner Spl Madgaon Bikaner Jn
00114 Running Status Mao Jaipur Spl Madgaon Jaipur
01182 Running Status Swv Ltt Special Sawantwadi Road Lokmanyatilak T
01070 Running Status Pern Ltt Special Pernem Lokmanyatilak T
01069 Running Status Ltt Pern Spl Lokmanyatilak T Pernem
01001 Running Status CSMT SWV SPL C Shivaji Mah T Sawantwadi Road
01002 Running Status SWV CSMT SPL Sawantwadi Road C Shivaji Mah T
81052 Running Status Thvm Ltt Suvidha Thivim Lokmanyatilak T
81015 Running Status Pnvl Thvm Spl Panvel Thivim
81051 Running Status Thvm Suvidha Spl Lokmanyatilak T Thivim
82129 Running Status Krmi Suvidha Spl Lokmanyatilak T Karmali
81045 Running Status Ltt Krmi Suvidha Lokmanyatilak T Karmali
01043 Running Status Ltt Karmali Spl Lokmanyatilak T Karmali
01044 Running Status Krmi Ltt Spl Karmali Lokmanyatilak T
81049 Running Status Krmi Suvidha Spl Panvel Karmali
81047 Running Status Krmi Suvidha Spl Lokmanyatilak T Karmali
01048 Running Status Krmi Ltt Spl Karmali Lokmanyatilak T
01582 Running Status Mao Pnvl Spl Madgaon Panvel
01588 Running Status Mao Pnvl Spl Madgaon Panvel
01585 Running Status Pnvl Kudl Spl Panvel Kudal
01581 Running Status Pnvl Mao Special Panvel Madgaon
01594 Running Status Kudl Pnvl Spl Kudal Panvel
01593 Running Status Pnvl Kudl Spl Panvel Kudal
09150 Running Status Vs Kudl Special Vishvamitri Kudal
01598 Running Status Mao Udn Spl Madgaon Udhna Jn
09149 Running Status Kudal Vs Spl Kudal Vishvamitri
01227 Running Status Csmt Swv Special C Shivaji Mah T Sawantwadi Road
01231 Running Status Pnvl Swv Special Panvel Sawantwadi Road
01228 Running Status Swv Csmt Special Sawantwadi Road C Shivaji Mah T
01599 Running Status Mao Bsp Spl Madgaon Bilaspur Jn
01232 Running Status Swv Pnvl Special Sawantwadi Road Panvel
01586 Running Status Kudl Pnvl Spl Pune Jn Talegaon
01587 Running Status Pnvl Mao Spl Talegaon Pune Jn
01257 Running Status Ltt Thvm Fes Spl Lokmanyatilak T Thivim
01260 Running Status Swv Pnvl Spl Thivim Panvel
01259 Running Status Pnvl Swv Spl Panvel Thivim
01258 Running Status Thvm Ltt Sf Spl Thivim Lokmanyatilak T
01596 Running Status Mao Pnvl Spl Madgaon Panvel
01595 Running Status Pnvl Mao Special Panvel Madgaon
01410 Running Status Festival Spl Nizamabad Jn Pune Jn
01409 Running Status Mao Festival Spl Daund Jn Nizamabad Jn
111010 Running Status Mandovi Express C Shivaji Mah T Madgaon
111100 Running Status Tutari Express Dadar Sawantwadi Road
50105 Running Status Diva Swv Pass Diva Sawantwadi Road
10106 Running Status Swv Diva Spl Sawantwadi Road Diva
111011 Running Status Konkan Kanya Ex C Shivaji Mah T Madgaon
10101 Running Status Rn Madgaon Spl Ratnagiri Madgaon
10102 Running Status Madgaon Rn Spl Madgaon Ratnagiri
50101 Running Status Ratnagiri Madgaon Ratnagiri Madgaon
50102 Running Status Madgaon Ratnagiri Madgaon Ratnagiri
10104 Running Status Festival Special Madgaon C Shivaji Mah T
10112 Running Status Festival Special Madgaon C Shivaji Mah T
10112X Running Status Konkan Kanya Ex Madgaon C Shivaji Mah T
10104X Running Status Mandovi Expres Madgaon C Shivaji Mah T
11004 Running Status Tutari Express Sawantwadi Road Dadar
50106 Running Status Swv Diva Pass Sawantwadi Road Diva
10103 Running Status Mandovi Express C Shivaji Mah T Madgaon
11003 Running Status Tutari Express Dadar Sawantwadi Road
01239 Running Status Ngp Krmi Sf Spl Nagpur Karmali
01004 Running Status Swv Dr Spl Sawantwadi Road Dadar
09188 Running Status Krmi Surat Spl Karmali Surat
01505 Running Status Diva Swv Spl Diva Sawantwadi Road
01505 Running Status Diva Swv Spl Diva Sawantwadi Road
01240 Running Status Krmi Ngp Sf Spl Karmali Nagpur
09187 Running Status St Karmali Spl Surat Karmali
10111 Running Status Konkan Kanya Ex C Shivaji Mah T Madgaon

Rating and reviews of Rajapur Road

reviewed on Jun 17 2022
this is best place ever to visit.. everything is natural and heart warming... feeling blessed to be here... it's all i was needed just like I need "PROTEIN" 💞in my life
reviewed on May 19 2022
rajapur khupach sundar Stephan
reviewed on Mar 04 2022
fisosjfiwodksofnshcoskxxko
reviewed on Jan 28 2022
....................mmmmmm.........................
reviewed on Jan 24 2022
mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm
reviewed on Dec 26 2021
pav bhagi and kachodi and samosa
reviewed on Dec 05 2021
asghragmagmfqnfanfkgqnnfmfafmagmsgmagmagmagmwt
reviewed on Dec 05 2021
awesomely food and cleaning is high level
reviewed on Nov 11 2021
Good, neat place, yes need mode upgrade, but overall station in good condition.
reviewed on Aug 29 2021
बसायाच्या जागा ठीक स्वच्छ नाही
Find out the list of trains that arrive at Rajapur Road railway station. Get information for all trains passing through Rajapur Road - Arrival, Departure, Train Number, Stops, Stoppage time, Platform Number, and Timings. Some of the trains that arrive at Rajapur Road railway station are 00128 MADGAON - CSMT KOLHAPUR ONE WAY SPECIAL FARE SPECIAL, 01415 SWV PNVL SPL, 01194 KRMI LTT SPL and 01047 PNVL SWV SPL. When you click on a train name or number, you get the complete schedule of that train. you can also check the live train running status of all the trains arriving or departing from Rajapur Road railway station. Search for trains to other train stations Use the complete train list for Rajapur Road to find seat availability on different trains. Use our cutting-edge PNR Status Prediction feature to know about your chances of confirmation of a waitlisted train ticket.
sponsored
sponsored